CDS

Accession Number TCMCG047C12523
gbkey CDS
Protein Id GFP91088.1
Location 338932..339111
Organism Phtheirospermum japonicum
locus_tag PHJA_001252800

Protein

Length 59aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB3858 BioSample:SAMD00029051
db_source BMAC01000235.1
Definition 50S ribosomal protein l20 chloroplastic [Phtheirospermum japonicum]
Locus_tag PHJA_001252800

EGGNOG-MAPPER Annotation

COG_category J
Description Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit
KEGG_TC -
KEGG_Module M00178        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE br01610        [VIEW IN KEGG]
ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03011        [VIEW IN KEGG]
KEGG_ko ko:K02887        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03010        [VIEW IN KEGG]
map03010        [VIEW IN KEGG]
GOs GO:0000027        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003735        [VIEW IN EMBL-EBI]
GO:0005198        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009526        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009941        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0042254        [VIEW IN EMBL-EBI]
GO:0042255        [VIEW IN EMBL-EBI]
GO:0042273        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0070925        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACCAGAATTAAACGCGGATATATAGTTCGGAGACGTAGAACACAAATTCGTTTATTTGCATCAAGTTTTCGGGGGGCCCATTCAAGACTTACTCGAACTATTACTCAACAGAAAATAAGAGATTTTGTTTCGGCTCATCGGGAGCGCAACCCCCTTTTTCTTTTTGGCCTTTTTTAA
Protein:  
MTRIKRGYIVRRRRTQIRLFASSFRGAHSRLTRTITQQKIRDFVSAHRERNPLFLFGLF